PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g055910.2
Common NameMTR_6g055910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 214aa    MW: 24606.3 Da    PI: 4.6873
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g055910.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-14344548
                     -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     ++ E++++  ++++lG++ W+ Ia+ ++ gRt++++k++w++yl
  Medtr6g055910.2  3 SKHEEDKIMTLHQMLGNK-WSQIAQQLP-GRTDNEIKNYWHSYL 44
                     689***************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.662148IPR017930Myb domain
SuperFamilySSF466897.8E-13350IPR009057Homeodomain-like
PfamPF002495.2E-13344IPR001005SANT/Myb domain
SMARTSM007172.7E-8346IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-21345IPR009057Homeodomain-like
CDDcd001678.98E-10344No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MLSKHEEDKI MTLHQMLGNK WSQIAQQLPG RTDNEIKNYW HSYLKKKEVK SKDIESHTQI  60
QYASSSSDTM NSLLSTQKYA IQDPKYVLPE NINKSTATTH SDQSISKNYN TANEVCHSSL  120
PKLLFSEWLS LDQVNGCNSL NSDDSLVLKN GYDQNLIFQE NVIQMPEGQF GEEFHDSLIQ  180
NLENDVYYSQ IQMSNQVDEN ELVHYLNNDV MYV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013452392.11e-156myb transcription factor
RefseqXP_013452393.11e-156myb transcription factor
TrEMBLA0A072UKS61e-156A0A072UKS6_MEDTR; Myb transcription factor
TrEMBLA0A072UAI11e-156A0A072UAI1_MEDTR; Myb transcription factor
STRINGGLYMA16G31280.11e-82(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.15e-22myb domain protein 18
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]